4.38 Rating by ClearWebStats
itfacil.com is 4 years 5 months 1 week old. It has a .com as an domain extension. This domain is estimated value of $ 8.95 and has a daily earning of $ 0.15. While no active threats were reported recently by users, itfacil.com is SAFE to browse.
Get Custom Widget

Traffic Report of Itfacil

Daily Unique Visitors: Not Applicable
Daily Pageviews: Not Applicable

Estimated Valuation

Income Per Day: $ 0.15
Estimated Worth: $ 8.95

Search Engine Indexes

Google Indexed Pages: Not Applicable
Yahoo Indexed Pages: Not Applicable
Bing Indexed Pages: Not Applicable

Search Engine Backlinks

Google Backlinks: Not Applicable
Bing Backlinks: Not Applicable
Alexa BackLinks: Not Applicable

Safety Information

Google Safe Browsing: No Risk Issues
Siteadvisor Rating: Not Applicable
WOT Trustworthiness: Not Applicable
WOT Privacy: Not Applicable
WOT Child Safety: Not Applicable

Website Ranks & Scores

Google Pagerank: Not Applicable
Alexa Rank: Not Applicable
Domain Authority: Not Applicable
Google Pagerank
PR 0 out of 10
PageSpeed Score
100
Siteadvisor Rating
View itfacil.com site advisor rating Not Applicable

Where is itfacil.com server located?

Hosted IP Address:

192.185.193.184 View other site hosted with itfacil.com

Hosted Country:

itfacil.com hosted country US itfacil.com hosted country

Location Latitude:

29.8324

Location Longitude:

-95.472

Social Engagement

Facebook Shares: Not Applicable
Facebook Likes: Not Applicable
Facebook Comments: Not Applicable
Twitter Count (Tweets): Not Applicable
Linkedin Shares: Not Applicable
Delicious Shares: Not Applicable

Page Resources Breakdown

View itfacil.com HTML resources

Homepage Links Analysis

Website Inpage Analysis

H1 Headings: 1 H2 Headings: Not Applicable
H3 Headings: Not Applicable H4 Headings: Not Applicable
H5 Headings: Not Applicable H6 Headings: Not Applicable
Total IFRAMEs: Not Applicable Total Images: Not Applicable
Google Adsense: Not Applicable Google Analytics: Not Applicable

Websites Hosted on Same IP (i.e. 192.185.193.184)

National Punctuation Day

itfacil.com favicon - nationalpunctuationday.com

National Punctuation Day, September 24, celebrates the importance of proper punctuation.

View itfacil.com Pagerank   itfacil.com alexa rank 1,388,281   itfacil.com website value $ 480.00

Vios Publicidad - Módulos Publicitarios y estructuras

itfacil.com favicon - viospublicidad.com

>Empresa con 30 años de experiencia brinda buen acabado y precios competitivos en sus servicios. Módulos Publicitarios, Estructuras Metálicas, Diseño

View itfacil.com Pagerank   itfacil.com alexa rank Not Applicable   itfacil.com website value $ 8.95

Flor - Flor

itfacil.com favicon - flor-moda.com

Texteis

View itfacil.com Pagerank   itfacil.com alexa rank Not Applicable   itfacil.com website value $ 8.95


Craig Watkins Criminal Defense Lawyer

itfacil.com favicon - craigwatkinscriminaldefenselawyer.com

View itfacil.com Pagerank   itfacil.com alexa rank Not Applicable   itfacil.com website value $ 8.95

HTTP Header Analysis

HTTP/1.1 200 OK
Date: Sun, 24 Nov 2019 10:23:43 GMT
Server: Apache
Upgrade: h2,h2c
Connection: Upgrade
Vary: Accept-Encoding
Content-Encoding: gzip
Content-Length: 349
Content-Type: text/html;charset=ISO-8859-1

Domain Information for itfacil.com

Domain Registrar: GODADDY.COM, LLC itfacil.com registrar info
Registration Date: 2019-11-21 4 years 5 months 1 week ago
Last Modified: 2019-11-21 4 years 5 months 1 week ago

Domain Nameserver Information

Host IP Address Country
ns623.websitewelcome.com itfacil.com name server information 192.185.193.160 itfacil.com server is located in United States United States
ns624.websitewelcome.com itfacil.com name server information 192.185.193.161 itfacil.com server is located in United States United States

DNS Record Analysis

Host Type TTL Extra
itfacil.com A 14399 IP:192.185.193.184
itfacil.com NS 21599 Target:ns624.websitewelcome.com
itfacil.com NS 21599 Target:ns623.websitewelcome.com
itfacil.com SOA 21599 MNAME:ns623.websitewelcome.com
RNAME:diosnelayalag.gmail.com
Serial:2019112103
Refresh:86400
Retry:7200
Expire:3600000
itfacil.com MX 14399 Target:mail.itfacil.com
itfacil.com TXT 14399 TXT:v=spf1 a mx include:websitewelcome.com
~all

Similarly Ranked Websites to Itfacil

Google

itfacil.com favicon - google.com

Search the world's information, including webpages, images, videos and more. Google has many special features to help you find exactly what you're looking for.

View itfacil.com Pagerank   Alexa rank for itfacil.com 1   website value of itfacil.com $ 8,833,062,960.00

Google Calendar - Sign in to Access & Edit Your Schedule

itfacil.com favicon - calendar.google.com

Access Google Calendar with a Google account (for personal use) or Google Workspace account (for business use).

View itfacil.com Pagerank   Alexa rank for itfacil.com 1   website value of itfacil.com $ 8,833,062,960.00

Gmail

itfacil.com favicon - mail.google.com

Gmail is email that’s intuitive, efficient, and useful. 15 GB of storage, less spam, and mobile access.

View itfacil.com Pagerank   Alexa rank for itfacil.com 1   website value of itfacil.com $ 8,833,062,960.00

Android Apps on Google Play

itfacil.com favicon - play.google.com

Enjoy millions of the latest Android apps, games, music, movies, TV, books, magazines & more. Anytime, anywhere, across your devices.

View itfacil.com Pagerank   Alexa rank for itfacil.com 1   website value of itfacil.com $ 8,833,062,960.00

Google Chrome - Download the Fast, Secure Browser from Google

itfacil.com favicon - chrome.google.com

Get more done with the new Google Chrome. A more simple, secure, and faster web browser than ever, with Google’s smarts built-in. Download now.

View itfacil.com Pagerank   Alexa rank for itfacil.com 1   website value of itfacil.com $ 8,833,062,960.00

Full WHOIS Lookup for itfacil.com

Domain Name: ITFACIL.COM
Registry Domain ID: 2457886916_DOMAIN_COM-VRSN
Registrar WHOIS Server: whois.godaddy.com
Registrar URL: http://www.godaddy.com
Updated Date: 2019-11-21T17:35:16Z
Creation Date: 2019-11-21T17:28:46Z
Registry Expiry Date: 2020-11-21T17:28:46Z
Registrar: GoDaddy.com, LLC
Registrar IANA ID: 146
Registrar Abuse Contact Email: [email protected]
Registrar Abuse Contact Phone: 480-624-2505
Domain Status: clientDeleteProhibited https://icann.org/epp#clientDeleteProhibited
Domain Status: clientRenewProhibited https://icann.org/epp#clientRenewProhibited
Domain Status: clientTransferProhibited https://icann.org/epp#clientTransferProhibited
Domain Status: clientUpdateProhibited https://icann.org/epp#clientUpdateProhibited
Name Server: NS623.WEBSITEWELCOME.COM
Name Server: NS624.WEBSITEWELCOME.COM
DNSSEC: unsigned
URL of the ICANN Whois Inaccuracy Complaint Form: https://www.icann.org/wicf/
>>> Last update of whois database: 2019-11-24T10:23:30Z